Package: newdata 0.0.0.9024

newdata: Generate New Data Frames for Prediction
Generates new data frames for predictive purposes. By default, all specified variables vary across their range while all other variables are held constant at the default reference value. Types, classes, factor levels and time zones are always preserved. The user can specify the length of each sequence, require that only observed values and combinations are used and add new variables.
Authors:
newdata_0.0.0.9024.tar.gz
newdata_0.0.0.9024.zip(r-4.5)newdata_0.0.0.9024.zip(r-4.4)newdata_0.0.0.9024.zip(r-4.3)
newdata_0.0.0.9024.tgz(r-4.5-any)newdata_0.0.0.9024.tgz(r-4.4-any)newdata_0.0.0.9024.tgz(r-4.3-any)
newdata_0.0.0.9024.tar.gz(r-4.5-noble)newdata_0.0.0.9024.tar.gz(r-4.4-noble)
newdata_0.0.0.9024.tgz(r-4.4-emscripten)newdata_0.0.0.9024.tgz(r-4.3-emscripten)
newdata.pdf |newdata.html✨
newdata/json (API)
NEWS
# Install 'newdata' in R: |
install.packages('newdata', repos = c('https://poissonconsulting.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/poissonconsulting/newdata/issues
Pkgdown site:https://poissonconsulting.github.io
- old_data - Example Data
Last updated 13 days agofrom:177e042559. Checks:8 OK. Indexed: yes.
Target | Result | Latest binary |
---|---|---|
Doc / Vignettes | OK | Feb 05 2025 |
R-4.5-win | OK | Feb 05 2025 |
R-4.5-mac | OK | Feb 05 2025 |
R-4.5-linux | OK | Feb 05 2025 |
R-4.4-win | OK | Feb 05 2025 |
R-4.4-mac | OK | Feb 05 2025 |
R-4.3-win | OK | Feb 05 2025 |
R-4.3-mac | OK | Feb 05 2025 |
Exports:new_datanew_seqnew_valuexcastxnew_dataxnew_seqxnew_valuexobs_only
Dependencies:chkclicpp11dplyrfansigenericsgluehmslifecyclemagrittrpillarpkgconfigpurrrR6rlangstringistringrtibbletidyrtidyselectutf8vctrswithr
Readme and manuals
Help Manual
Help page | Topics |
---|---|
Generate New Data *[Superseded]* | new_data |
Generate New Sequence | new_seq new_seq.character new_seq.Date new_seq.double new_seq.factor new_seq.hms new_seq.integer new_seq.logical new_seq.ordered new_seq.POSIXct |
Generate New Reference Value | new_value |
Example Data | old_data |
Cast New Values for 'xnew_data()' | xcast |
Generate New Data by Expansion | xnew_data |
Generate New Sequence for 'xnew_data()' | xnew_seq |
Generate New Reference Value for 'xnew_data()' | xnew_value |
Generate Observed Combinations Only | xobs_only |